TA335457 TAF7L antibody

Rabbit Polyclonal Anti-TAF7L Antibody

See related secondary antibodies

Search for all "TAF7L"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat TAF7L

Product Description for TAF7L

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat TAF7L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TAF7L

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CT40, Cancer/testis antigen 40, RNA polymerase II TBP-associated factor subunit Q, TAF2Q, TATA box-binding protein-associated factor 50 kDa, Transcription initiation factor TFIID 50 kDa subunit, Transcription initiation factor TFIID subunit 7-like
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5H9L4
Immunogen:
The immunogen for Anti-TAF7L Antibody: synthetic peptide directed towards the middle region of human TAF7L. Synthetic peptide located within the following region: QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQ.
GeneID:
54457
Application WB
Background TAF7L gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression.This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TAF7L (2 products)

Catalog No. Species Pres. Purity   Source  

TAF7L

TAF7L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TAF7L

TAF7L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TAF7L (1 products)

Catalog No. Species Pres. Purity   Source  

TAF7L overexpression lysate

TAF7L overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn