TA339448 TARDBP antibody

Rabbit Polyclonal Anti-TARDBP Antibody

See related secondary antibodies

Search for all "TARDBP"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish TARDBP


More Views

  • TA339448

Product Description for TARDBP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish TARDBP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TARDBP

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms TAR DNA-binding protein 43, TDP-43, TDP43
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the N terminal of human TARDBP. Synthetic peptide located within the following region: VYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLK.
Application WB
Background HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an R genome that produces a chromosomally integrated D during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an R regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptiol repressor that binds to chromosomally integrated TAR D and represses HIV-1 transcription. In addition, this protein regulates alterte splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. [provided by RefSeq, Jul 2008].
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for TARDBP (8 products)

Catalog No. Species Pres. Purity   Source  


TARDBP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

TARDBP (1-260, His-tag)

TARDBP Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €730.00
  OriGene Technologies GmbH

TARDBP (1-260, His-tag)

TARDBP Human Purified > 90 % by SDS - PAGE E. coli
20 µg / €300.00
  OriGene Technologies GmbH

TARDBP (1-414, His-tag)

TARDBP Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

TARDBP (1-414, His-tag)

TARDBP Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH


TARDBP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


TARDBP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


TARDBP Human Purified 95 % E. coli
  GenWay Biotech Inc.

Positive controls for TARDBP (1 products)

Catalog No. Species Pres. Purity   Source  


Western Blot: TARDBP Lysate [NBL1-16701] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TARDBP
  Novus Biologicals Inc.
  • LinkedIn