discontinued

H00006909-M01 TBX2 antibody

See related secondary antibodies

Search for all "TBX2"

Quick Overview

Mouse anti Human TBX2 7G5

H00006909-M01

More Views

  • H00006909-M01
  • H00006909-M01
  • H00006909-M01
  • H00006909-M01

Product Description for TBX2

Mouse anti Human TBX2 7G5.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for TBX2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms T-box protein 2
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, WB
Clonality Monoclonal
Clone 7G5
Host Mouse
Isotype IgG3
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13207
Immunogen:
TBX2 (NP_005985, 603 a.a. ~ 703 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
GSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANEL QSIQRLVSGLESQRALSPGRESPK*
GeneID:
6909
Remarks:
Gene Accession: NM_005994
Isotype control AM03097PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant TBX2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,RNAi-Ab,S-ELISA,WB-Ce,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 6909

Accessory Products

Proteins and/or Positive Controls

Proteins for TBX2 (4 products)

Catalog No. Species Pres. Purity   Source  

TBX2

TBX2 Human Purified
  Abnova Taiwan Corp.

TBX2

TBX2 Human Purified
  Abnova Taiwan Corp.

TBX2

TBX2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TBX2

TBX2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn