H00006964-M01 TCRD / TCRDV1 / TRD antibody

See related secondary antibodies

Search for all "TCRD / TCRDV1 / TRD"

0.1 mg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human TCRD / TCRDV1 / TRD 2H6

Product Description for TCRD / TCRDV1 / TRD

Mouse anti Human TCRD / TCRDV1 / TRD 2H6.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for TCRD / TCRDV1 / TRD

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms T cell receptor delta locus, TRD@
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2H6
Host Mouse
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
TRD@ (CAA29800, 173 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
LVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKS CHKPKAIVHTEKVNMMSLTVLGLR*
Remarks:
Gene Accession: X06557
Add. information Mouse monoclonal antibody raised against a partial recombinant TRD@.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody Reactive Against Recombinant Protein.
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn