TA343054 TCRG antibody

See related secondary antibodies

Search for all "TCRG"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human, Mouse, Porcine, Rat TCRG

Product Description for TCRG

Rabbit anti Equine, Human, Mouse, Porcine, Rat TCRG.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TCRG

Product Category Primary Antibodies
Quantity 50 µg
Synonyms TCRgamma alternate reading frame protein
Presentation Purified
Reactivity Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-TARP antibody: synthetic peptide directed towards the N terminal of human TARP. Synthetic peptide located within the following region: YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK.
Application WB
Background In some non-lymphoid tissues, the unrearranged T cell receptor gamma (TRG@) locus is expressed. The resulting transcript contains a subset of the TRG@ gene segments and is shorter than TRG@ transcripts expressed in lymphoid tissues. This RefSeq record represents the unrearranged TRG@ locus transcript; the complete TRG@ locus is represented by the genomic RefSeq NG_001336. The transcript represented by this RefSeq has two open reading frames (ORFs) that encode different proteins. The downstream ORF is in the same frame as TRG@ and its protein product is similar to TRG@ proteins. The upstream ORF uses a different reading frame and encodes a novel protein.
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 813% sucrose.

Accessory Products

Proteins and/or Positive Controls

Positive controls for TCRG (1 products)

Catalog No. Species Pres. Purity   Source  

TARP overexpression lysate

TARP overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn