discontinued

H00006976-B01 TCRGV3 antibody

See related secondary antibodies

Search for all "TCRGV3"

50 µl / €370.00

Quick Overview

Mouse anti Human TCRGV3

H00006976-B01

Product Description for TCRGV3

Mouse anti Human TCRGV3.
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for TCRGV3

Product Category Primary Antibodies
Quantity 50 µl
Synonyms T cell receptor gamma variable 3, TRGV3, V1S3
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
TRGV3 (AAH71739.1, 1 a.a. ~ 200 a.a) full-length human protein.
AA Sequence:
MRWALLVLLAFLSPASQKSSNLEGRTKSVTRQTGSSAEITCDLTVTNTFYIHWYLHQEGKAPQRLLYYDVSTARDV LESGLSPGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWDRHSDSDLSYTTLKICLVAASGTQDRAAPSHFLPPN FLYSEQEKDSLTPDLPPNITLSWQQLHPVPHPSPTTFLKIKLPSPGLS
Remarks:
Gene Accession: BC071739.1
Add. information Mouse polyclonal antibody raised against a full-length human TRGV3 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
Specificity
Species:
Human

Accessory Products

  • LinkedIn