H00006976-B01P TCRGV3 antibody

See related secondary antibodies

Search for all "TCRGV3"

50 µg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human TCRGV3

Product Description for TCRGV3

Mouse anti Human TCRGV3.
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for TCRGV3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms T cell receptor gamma variable 3, TRGV3, V1S3
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
TRGV3 (AAH71739.1, 1 a.a. ~ 200 a.a) full-length human protein.
AA Sequence:
MRWALLVLLAFLSPASQKSSNLEGRTKSVTRQTGSSAEITCDLTVTNTFYIHWYLHQEGKAPQRLLYYDVSTARDV LESGLSPGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWDRHSDSDLSYTTLKICLVAASGTQDRAAPSHFLPPN FLYSEQEKDSLTPDLPPNITLSWQQLHPVPHPSPTTFLKIKLPSPGLS
Remarks:
Gene Accession: BC071739.1
Add. information Mouse polyclonal antibody raised against a full-length human TRGV3 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody reactive against mammalian transfected lysate.
Specificity
Species:
Human

Accessory Products

  • LinkedIn