H00006975-B01P TECTB antibody

See related secondary antibodies

Search for all "TECTB"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human TECTB

H00006975-B01P

Product Description for TECTB

Mouse anti Human TECTB.
Product is tested for Western blot / Immunoblot.

Properties for TECTB

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms KIAA1560, MGC142057, MGC142059
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96PL2
Immunogen:
TECTB (ADR82948.1, 1 a.a. ~ 329 a.a) full-length human protein.
AA Sequence:
MVTKAFVLLAIFAEASAKSCAPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDL SPKNKSYCGTQSEYKPPIYHFYSHIVSNDTTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFE SQLSLNFYTNAKFSIKKEAPFVLEASEIGSDLFAGVEAKGLSIRFKVVLNSCWATPSADFMYPLQWQLINKGCPTD ETVLVHENGRDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVTCDKRKRLLRDQTGGVLVVELSLRSR GFSSLYSFSDVLHHLIMMLGICAVL
GeneID:
6975
Add. information Mouse polyclonal antibody raised against a full-length human TECTB protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn