TA335587 Tectonic-3 antibody

Rabbit Polyclonal Anti-TCTN3 Antibody

See related secondary antibodies

Search for all "Tectonic-3"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Tectonic-3

TA335587

More Views

  • TA335587

Product Description for Tectonic-3

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Tectonic-3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Tectonic-3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms C10orf61, TCTN3, TECT3
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6NUS6
Immunogen:
The immunogen for Anti-TCTN3 Antibody: synthetic peptide directed towards the middle region of human TCTN3. Synthetic peptide located within the following region: LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS.
GeneID:
26123
Application WB
Background TCTN3 may be involved in apoptosis regulation.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Tectonic-3 (1 products)

Catalog No. Species Pres. Purity   Source  

TCTN3 Lysate

Western Blot: TCTN3 Lysate [NBL1-16796] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TCTN3
  Novus Biologicals Inc.
  • LinkedIn