
NBP1-74181 TEKT3 antibody

See related secondary antibodies

Search for all "TEKT3"

50 µg / €440.00

Quick Overview

Rabbit anti Rat TEKT3


Product Description for TEKT3

Rabbit anti Rat TEKT3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TEKT3

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to the N terminal of Tekt3. Immunizing peptide sequence MLPFVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERLRVDTSRLIQ.
Background Tekt3 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules. It is required for progressive sperm mobility.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
Aff - Purified
Gene ID 287392

Accessory Products

  • LinkedIn