TA330800 Tetraspanin-11 / TSPAN11 antibody

Rabbit Polyclonal Anti-TSPAN11 Antibody

See related secondary antibodies

Search for all "Tetraspanin-11 / TSPAN11"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine Tetraspanin-11 / TSPAN11

Product Description for Tetraspanin-11 / TSPAN11

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine Tetraspanin-11 / TSPAN11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Tetraspanin-11 / TSPAN11

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms TSPAN-11, Tetraspanin 11
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A1L157
Immunogen:
The immunogen for Anti-TSPAN11 antibody is: synthetic peptide directed towards the middle region of Human TSPAN11. Synthetic peptide located within the following region: HLNRTLAENYGQPGATQITASVDRLQQDFKCCGSNSSADWQHSTYILLRE.
GeneID:
441631
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Tetraspanin-11 / TSPAN11 (1 products)

Catalog No. Species Pres. Purity   Source  

TSPAN11 overexpression lysate

TSPAN11 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn