NBP1-74070 Tetraspanin-33 antibody

See related secondary antibodies

Search for all "Tetraspanin-33"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Rat Tetraspanin-33

NBP1-74070

Product Description for Tetraspanin-33

Rabbit anti Rat Tetraspanin-33.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Tetraspanin-33

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A4RV40
Immunogen:
Synthetic peptides corresponding to the C terminal of Tspan33. Immunizing peptide sequence NTMCGQGMQALDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIP.
GeneID:
5000650
Background The function of this protein remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Reconstitute with 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 5000650

Accessory Products

  • LinkedIn