discontinued

H00007032-B01 TFF2 antibody

See related secondary antibodies

Search for all "TFF2"

50 µl / €370.00

Quick Overview

Mouse anti Human TFF2

H00007032-B01

More Views

  • H00007032-B01

Product Description for TFF2

Mouse anti Human TFF2.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for TFF2

Product Category Primary Antibodies
Quantity 50 µl
Synonyms MaxPab, SML1, SP, spasmolytic protein 1, trefoil factor 2
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
TFF2 (NP_005414.1, 1 a.a. ~ 129 a.a) full-length human protein.
AA Sequence:
MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQ ESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY
Remarks:
Gene Accession: NM_005423.3
Add. information Mouse polyclonal antibody raised against a full-length human TFF2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IHC-P,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
State:
Serum
Specificity
Species:
Human

Accessory Products

  • LinkedIn