
NBP1-74137 Thyroid Hormone Receptor alpha antibody

See related secondary antibodies

Search for all "Thyroid Hormone Receptor alpha"

Quick Overview

Rabbit anti Rat Thyroid Hormone Receptor alpha


Product Description for Thyroid Hormone Receptor alpha

Rabbit anti Rat Thyroid Hormone Receptor alpha.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Thyroid Hormone Receptor alpha

Product Category Primary Antibodies
Quantity 50 µg
Synonyms c-ERBA-1
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to the C terminal of Thra. Immunizing peptide sequence MSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKVTDL.
Background Thra binds the promoter of the Na+/H+ exchanger NHE1 and mediates thyroid hormone induced transcriptional activation.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
Aff - Purified
Gene ID 81812

Accessory Products

  • LinkedIn