discontinued

NBP1-74137 Thyroid Hormone Receptor alpha antibody

See related secondary antibodies

Search for all "Thyroid Hormone Receptor alpha"

50 µg / €390.00

Quick Overview

Rabbit anti Rat Thyroid Hormone Receptor alpha

NBP1-74137

Product Description for Thyroid Hormone Receptor alpha

Rabbit anti Rat Thyroid Hormone Receptor alpha.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Thyroid Hormone Receptor alpha

Product Category Primary Antibodies
Quantity 50 µg
Synonyms c-ERBA-1
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P63059
Immunogen:
Synthetic peptides corresponding to the C terminal of Thra. Immunizing peptide sequence MSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKVTDL.
GeneID:
81812
Background Thra binds the promoter of the Na+/H+ exchanger NHE1 and mediates thyroid hormone induced transcriptional activation.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
State:
Aff - Purified
Gene ID 81812

Accessory Products

  • LinkedIn