discontinued

NBP1-68904 TM9SF1 antibody

See related secondary antibodies

Search for all "TM9SF1"

50 µg / €390.00

Quick Overview

Rabbit anti Human TM9SF1

NBP1-68904

Product Description for TM9SF1

Rabbit anti Human TM9SF1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TM9SF1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86SZ6
Immunogen:
Synthetic peptides corresponding to TM9SF1 (transmembrane 9 superfamily member 1) The peptide sequence was selected from the C terminal of TM9SF1. Peptide sequence LVGFVAVILMRVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVF.
GeneID:
10548
Background TM9SF1 may function as channel, small molecule transporter or receptor.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 10548

Accessory Products

  • LinkedIn