NBP1-59392 TMCC1 antibody

See related secondary antibodies

Search for all "TMCC1"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat TMCC1

Product Description for TMCC1

Rabbit anti Human, Mouse, Rat TMCC1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TMCC1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp686M0169, FLJ42680
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6N039
Immunogen:
Synthetic peptides corresponding to TMCC1(transmembrane and coiled-coil domain family 1) The peptide sequence was selected from the middle region of TMCC1. Peptide sequence YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK.
GeneID:
23023
Background TMCC1 is a multi-pass membrane proteinPotential. It belongs to the TEX28 family.The exact function of TMCC1 remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 23023

Accessory Products

  • LinkedIn