
NBP1-59392 TMCC1 antibody

See related secondary antibodies

Search for all "TMCC1"

Quick Overview

Rabbit anti Human, Mouse, Rat TMCC1

Product Description for TMCC1

Rabbit anti Human, Mouse, Rat TMCC1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TMCC1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp686M0169, FLJ42680
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to TMCC1(transmembrane and coiled-coil domain family 1) The peptide sequence was selected from the middle region of TMCC1. Peptide sequence YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK.
Background TMCC1 is a multi-pass membrane proteinPotential. It belongs to the TEX28 family.The exact function of TMCC1 remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 23023

Accessory Products

  • LinkedIn