TA333410 TMCO4 antibody

Rabbit Polyclonal Anti-TMCO4 Antibody

See related secondary antibodies

Search for all "TMCO4"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Rat TMCO4

Product Description for TMCO4

Rabbit anti Canine, Equine, Human, Mouse, Rat TMCO4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMCO4

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Transmembrane and coiled-coil domain-containing protein 4
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5TGY1
Immunogen:
The immunogen for Anti-TMCO4 Antibody: synthetic peptide directed towards the C terminal of human TMCO4. Synthetic peptide located within the following region: WPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFS.
GeneID:
255104
Application WB
Background The function of TMCO4 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TMCO4 (2 products)

Catalog No. Species Pres. Purity   Source  

TMCO4

TMCO4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TMCO4

TMCO4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn