H00145942-B01P TMCO5A antibody

See related secondary antibodies

Search for all "TMCO5A"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human TMCO5A

H00145942-B01P

Product Description for TMCO5A

Mouse anti Human TMCO5A.
Product is tested for Western blot / Immunoblot.

Properties for TMCO5A

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ35807, MGC35118, TMCO5
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N6Q1
Immunogen:
TMCO5A (NP_689666.2, 1 a.a. ~ 288 a.a) full-length human protein.
AA Sequence:
MEISRLAQSKRNIISLNMDLERDTQRIDEANQKLLLKIQEREDKIQRLESEIIQTRGLVEDEEWEKENRTTMERER ALQELEEETARLERKNKTLVHSITELQQKLTRKSQKITNCEQSSPDGALEETKVKLQQLEASYACQEKELLKVMKE YAFVTQLCEDQALYIKKYQETLKKIEEELEALFLEREVSKLVSMNPVEKEHTSQNNEGTPTQKTARLFSKKIFCCL FFITLFFIRLLSYMFFHVRFINPDLLVNVLPKVLGRSTLWKLRCFFFPSLTLETEDMLPH
GeneID:
145942
Add. information Mouse polyclonal antibody raised against a full-length human TMCO5A protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn