discontinued

NBP1-91101 TMEM120B antibody

See related secondary antibodies

Search for all "TMEM120B"

Quick Overview

Rabbit anti Human TMEM120B

Product Description for TMEM120B

Rabbit anti Human TMEM120B.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for TMEM120B

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A0PK00
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: THRIYKQKLEELAALQTLCSSSISKQKKHLKDLKLTLQRCKRHASREEAELVQQMAANIKERQDVFFDMEAYLPKKNGLYLNLVLGNVNVTLLSNQAKFAYKD
GeneID:
144404
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 144404

Accessory Products

Proteins and/or Positive Controls

Positive controls for TMEM120B (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM120B overexpression lysate

TMEM120B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn