
NBP1-59978 TMEM126B antibody

See related secondary antibodies

Search for all "TMEM126B"

0.1 mg / €360.00

Quick Overview

Rabbit anti Human TMEM126B

Product Description for TMEM126B

Rabbit anti Human TMEM126B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMEM126B

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to TMEM126B(transmembrane protein 126B) The peptide sequence was selected from the middle region of TMEM126B. Peptide sequence VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC.
Background The function remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
Gene ID 55863

Accessory Products

  • LinkedIn