H00092305-B01P TMEM129 antibody

See related secondary antibodies

Search for all "TMEM129"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human TMEM129

H00092305-B01P

Product Description for TMEM129

Mouse anti Human TMEM129.
Product is tested for Western blot / Immunoblot.

Properties for TMEM129

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms D4S2561E, FLJ25600
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A0AVI4
Immunogen:
TMEM129 (NP_612394.1, 1 a.a. ~ 232 a.a) full-length human protein.
AA Sequence:
MDSPEVTFTLAYLVFAVCFVFTPNEFHAAGLTVQNLLSGWLGSEDAAFVPFHLRRTAATLLCHSLLPLGYYVGMCL AASEKRLHALSQAPEAWRLFLLLAVTLPSIACILIYYWSRDRWACHPLARTLALYALPQSGWQAVASSVNTEFRRI DKFATGAPGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHELSPDSNLPVQLLTIRVASTNPAVQAFDIWS WRPA
GeneID:
92305
Add. information Mouse polyclonal antibody raised against a full-length human TMEM129 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for TMEM129 (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM129 overexpression lysate

TMEM129 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn