H00055281-B01P TMEM140 antibody

See related secondary antibodies

Search for all "TMEM140"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human TMEM140

H00055281-B01P

Product Description for TMEM140

Mouse anti Human TMEM140.
Product is tested for Western blot / Immunoblot.

Properties for TMEM140

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ11000
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NV12
Immunogen:
TMEM140 (AAH20942.1, 1 a.a. ~ 185 a.a) full-length human protein.
AA Sequence:
MAGPRPQWRDELLFMSIIVLVIVVICLMLYALLWEAGNLTDLPNLRIGFYNFCLWNEDTSTLQCHQFPELEALGVP RVGLGLARLGVYGSLVLTLFAPQPLLLAQCNSDERAWRLAVGFLAVSSVLLAGGLGLFLSYVWKWVRLSLPGPGFL ALGSAQALLILLLIAMAVFPLRAERAESKLESC
GeneID:
55281
Add. information Mouse polyclonal antibody raised against a full-length human TMEM140 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for TMEM140 (1 products)

Catalog No. Species Pres. Purity   Source  

Transmembrane protein 140 (TMEM140)

Transmembrane protein 140 (TMEM140) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for TMEM140 (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM140 overexpression lysate

TMEM140 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn