NBP1-94040 TMEM140 antibody

See related secondary antibodies

Search for all "TMEM140"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TMEM140


More Views

  • NBP1-94040

Product Description for TMEM140

Rabbit anti Human TMEM140.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for TMEM140

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NLTDLPNLRIGFYNFCLWNEDTSTLQCHQFPELEALG
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
Aff - Purified
Gene ID 55281

Accessory Products

Proteins and/or Positive Controls

Proteins for TMEM140 (1 products)

Catalog No. Species Pres. Purity   Source  

Transmembrane protein 140 (TMEM140)

Transmembrane protein 140 (TMEM140) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for TMEM140 (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM140 overexpression lysate

TMEM140 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn