H00201799-B01P TMEM154 antibody

See related secondary antibodies

Search for all "TMEM154"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human TMEM154

H00201799-B01P

Product Description for TMEM154

Mouse anti Human TMEM154.
Product is tested for Western blot / Immunoblot.

Properties for TMEM154

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ32028
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P9G4
Immunogen:
TMEM154 (AAH60775.1, 1 a.a. ~ 183 a.a) full-length human protein.
AA Sequence:
MQAPRAALVFALVIALVPVGRGNYEELENSGDTTVESERPNKVTIPSTFAAVTIKETLNANINSTNFAPDENQLEF ILMVLIPLILLVLLLLFVVFLATYYKRKRTKQEPSSQGSQSALQTYELGSENVKVPIFEEDTPSVMEIEMEELDKW MNSMNRNADFECLPTLKEEKESNHNPSDSES
GeneID:
201799
Add. information Mouse polyclonal antibody raised against a full-length human TMEM154 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for TMEM154 (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM154 overexpression lysate

TMEM154 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn