TA337836 TMEM161B antibody

Rabbit Polyclonal Anti-TMEM161B Antibody

See related secondary antibodies

Search for all "TMEM161B"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish TMEM161B

Product Description for TMEM161B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish TMEM161B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMEM161B

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Transmembrane protein 161B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NDZ6
Immunogen:
The immunogen for anti-TMEM161B antibody: synthetic peptide directed towards the N terminal of human TMEM161B. Synthetic peptide located within the following region: GSLRWYQHPTEEELRILAGKQQKGKTKKDRKYNGHIESKPLTIPKDIDLH.
GeneID:
153396
Application WB
Background The specific function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn