H00094107-B01P TMEM203 antibody

See related secondary antibodies

Search for all "TMEM203"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human TMEM203

H00094107-B01P

Product Description for TMEM203

Mouse anti Human TMEM203.
Product is tested for Western blot / Immunoblot.

Properties for TMEM203

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms HBEBP1, MGC14327, MGC15961
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q969S6
Immunogen:
TMEM203 (NP_444273.1, 1 a.a. ~ 136 a.a) full-length human protein.
AA Sequence:
MLFSLRELVQWLGFATFEIFVHLLALLVFSVLLALRVDGLVPGLSWWNVFVPFFAADGLSTYFTTIVSVRLFQDGE KRLAVLRLFWVLTVLSLKFVFEMLLCQKLAEQTRELWFGLITSPLFILLQLLMIRACRVN
GeneID:
94107
Add. information Mouse polyclonal antibody raised against a full-length human TMEM203 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for TMEM203 (2 products)

Catalog No. Species Pres. Purity   Source  

TMEM203 Lysate

Western Blot: TMEM203 Lysate [NBL1-17058] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for TMEM203.
0.1 mg / €400.00
  Novus Biologicals Inc.

TMEM203 overexpression lysate

TMEM203 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn