TA330790 TMEM215 antibody

Rabbit Polyclonal Anti-TMEM215 Antibody

See related secondary antibodies

Search for all "TMEM215"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TMEM215

Product Description for TMEM215

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TMEM215.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMEM215

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Transmembrane protein 215
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-TMEM215 antibody is: synthetic peptide directed towards the N-terminal region of Human TMEM215. Synthetic peptide located within the following region: WVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGKPPPQS.
Application WB
Background The function of this protein remains unknown.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for TMEM215 (1 products)

Catalog No. Species Pres. Purity   Source  


TMEM215 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for TMEM215 (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM215 overexpression lysate

TMEM215 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn