H00221468-B01P TMEM217 antibody

See related secondary antibodies

Search for all "TMEM217"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human TMEM217

H00221468-B01P

Product Description for TMEM217

Mouse anti Human TMEM217.
Product is tested for Western blot / Immunoblot.

Properties for TMEM217

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C6orf128, dJ355M6.2
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N7C4
Immunogen:
TMEM217 (ADZ15849.1, 1 a.a. ~ 211 a.a) full-length human protein.
AA Sequence:
MKQQQWCGMTAKMGTVLSGVFTIMAVDMYLIFEQKHLGNGSCTEITPKYRGASNIINNFIICWSFKIVLFLSFITI LISCFLLYSVYAQIFRGLVIYIVWIFFYETANVVIQILTNNDFDIKEVRIMRWFGLVSRTVMHCFWMFFVINYAHI TYKNRSQGNIISYKRRISTAEILHSRNKRLSISSGFSGSHLESQYFERQRRCSGKTSIK
GeneID:
221468
Add. information Mouse polyclonal antibody raised against a full-length human TMEM217 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn