discontinued

H00027112-A01 TMEM28 / FAM155B antibody

See related secondary antibodies

Search for all "TMEM28 / FAM155B"

Quick Overview

Mouse anti Human TMEM28 / FAM155B

Product Description for TMEM28 / FAM155B

Mouse anti Human TMEM28 / FAM155B.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for TMEM28 / FAM155B

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms TED, Transmembrane protein 28
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O75949
Immunogen:
TMEM28 (NP_056501, 245 a.a. ~ 342 a.a) partial recombinant protein with GST tag.
AA Sequence:
NCIEAYQRLDRHAQEKYDEFDLVLHKYLQAEEYSIRSCTKGCKAVYKAWLCSEYFSVTQQECQRWVPCKQYCLEVQ TRCPFILPDNEEMVYGGLPGF*
GeneID:
27112
Remarks:
Gene Accession: NM_015686
Add. information Mouse polyclonal antibody raised against a partial recombinant TMEM28.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 27112

Accessory Products

Proteins and/or Positive Controls

Proteins for TMEM28 / FAM155B (2 products)

Catalog No. Species Pres. Purity   Source  

TMEM28 / FAM155B

TMEM28 / FAM155B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TMEM28 / FAM155B

TMEM28 / FAM155B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TMEM28 / FAM155B (1 products)

Catalog No. Species Pres. Purity   Source  

FAM155B overexpression lysate

FAM155B overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn