TA335583 TMEM28 / FAM155B antibody

Rabbit Polyclonal Anti-FAM155B Antibody

See related secondary antibodies

Search for all "TMEM28 / FAM155B"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat TMEM28 / FAM155B

Product Description for TMEM28 / FAM155B

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat TMEM28 / FAM155B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMEM28 / FAM155B

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms TED, Transmembrane protein 28
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-FAM155B Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM155B. Synthetic peptide located within the following region: KDAAALTICCCCCCWAPRPSDKPCADSERAQRWRLSLASLLFFTVLLADH.
Application WB
Background This gene encodes a product belonging to a family of proteins with unknown function. The presence of two transmembrane domains suggests that this protein is a multi-pass membrane protein.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for TMEM28 / FAM155B (2 products)

Catalog No. Species Pres. Purity   Source  

TMEM28 / FAM155B

TMEM28 / FAM155B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TMEM28 / FAM155B

TMEM28 / FAM155B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TMEM28 / FAM155B (1 products)

Catalog No. Species Pres. Purity   Source  

FAM155B overexpression lysate

FAM155B overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn