discontinued

H00093109-B01P TMEM44 antibody

See related secondary antibodies

Search for all "TMEM44"

Quick Overview

Mouse anti Human TMEM44

H00093109-B01P

Product Description for TMEM44

Mouse anti Human TMEM44.
Product is tested for Western blot / Immunoblot.

Properties for TMEM44

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms DKFZp686O18124, MGC131692, MGC163169
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2T9K0
Immunogen:
TMEM44 (AAH34353.1, 1 a.a. ~ 171 a.a) full-length human protein.
AA Sequence:
MKSKMRQALGFAKEARESPDTQALLTCAEKEEENQENLDWVPLTTLSHCKSLRTMTAISRYMELTIEPVQQAGCSA TRLPGDGQTSAGDASLQDPPSYPPVQVIRARVSSGSSSEVSSINSDLEQKYWEALNSEQWDPEDVNLEGSKENVEL LGSQVHQDSVRTAHLSDDD
GeneID:
93109
Add. information Mouse polyclonal antibody raised against a full-length human TMEM44 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for TMEM44 (2 products)

Catalog No. Species Pres. Purity   Source  

TMEM44 overexpression lysate

TMEM44 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.

TMEM44 overexpression lysate

TMEM44 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn