NBP1-91059 TMEM52 antibody

See related secondary antibodies

Search for all "TMEM52"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TMEM52

Product Description for TMEM52

Rabbit anti Human TMEM52.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for TMEM52

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NDY8
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VIPMDSDSPVHSTVTSYSSVQYPLGMRLPLPFGELDLDSVAPPAYSLYTPEPPPSYDEAVKMAKPREEGPALSQKPSPLLGASGLETTPVPQESGPNTQLPP
GeneID:
339456
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 339456

Accessory Products

Proteins and/or Positive Controls

Proteins for TMEM52 (1 products)

Catalog No. Species Pres. Purity   Source  

Transmembrane protein 52 (TMEM52)

Transmembrane protein 52 (TMEM52) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for TMEM52 (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM52 overexpression lysate

TMEM52 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn