TA337856 TMEM74 antibody

Rabbit Polyclonal Anti-TMEM74 Antibody

See related secondary antibodies

Search for all "TMEM74"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TMEM74

Product Description for TMEM74

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TMEM74.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMEM74

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Transmembrane protein 74
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-TMEM74 antibody: synthetic peptide directed towards the middle region of human TMEM74. Synthetic peptide located within the following region: ERLEKESARLGAHLDRCVIAGLCLLTLGGVILSCLLMMSMWKGELYRRNR.
Application WB
Background TMEM74 plays an essential role in autophagy. TMEM74-induced autophagy may involve PI3K sigl transduction.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Positive controls for TMEM74 (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM74 Lysate

Western Blot: TMEM74 Lysate [NBL1-17103] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TMEM74
  Novus Biologicals Inc.
  • LinkedIn