H00055321-B01P TMEM74B antibody

See related secondary antibodies

Search for all "TMEM74B"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human TMEM74B

H00055321-B01P

Product Description for TMEM74B

Mouse anti Human TMEM74B.
Product is tested for Western blot / Immunoblot.

Properties for TMEM74B

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C20orf46, RP4-545L17.8
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NUR3
Immunogen:
TMEM74B (AAI56782.1, 1 a.a. ~ 256 a.a) full-length human protein.
AA Sequence:
MPPAQGYEFAAAKGPRDELGPSFPMASPPGLELKTLSNGPQAPRRSAPLGPVAPTREGVENACFSSEEHETHFQNP GNTRLGSSPSPPGGVSSLPRSQRDDLSLHSEEGPALEPVSRPVDYGFVSALVFLVSGILLVVTAYAIPREARVNPD TVTAREMERLEMYYARLGSHLDRCIIAGLGLLTVGGMLLSVLLMVSLCKGELYRRRTFVPGKGSRKTYGSINLRMR QLNGDGGQALVENEVVQVSETSHTLQRS
GeneID:
55321
Add. information Mouse polyclonal antibody raised against a full-length human TMEM74B protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for TMEM74B (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 20 open reading frame 46 (C20orf46)

Chromosome 20 open reading frame 46 (C20orf46) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for TMEM74B (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM74B overexpression lysate

TMEM74B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn