discontinued

H00051754-B01 TMEM8B antibody

See related secondary antibodies

Search for all "TMEM8B"

Quick Overview

Mouse anti Human, Rat TMEM8B

H00051754-B01

More Views

  • H00051754-B01
  • H00051754-B01

Product Description for TMEM8B

Mouse anti Human, Rat TMEM8B.
Presentation: Serum
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for TMEM8B

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms C9orf127, NAG5, Nasopharyngeal carcinoma-associated gene 6 protein, Protein NAG-5, Protein NGX6, Transmembrane protein 8B, chromosome 9 open reading frame 127
Presentation Serum
Reactivity Hu, Rt
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NDV4
Immunogen:
C9orf127 (AAH41377.1, 1 a.a. ~ 257 a.a) full-length human protein.
AA Sequence:
MWRPHFHTCPPQSSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLAL RSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQL LSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTVCGGVCILSLGACAWWWVTVCISTTFSEGLGMSVPS LCLLQTETAVLPKLSCIDNGHFCKTHWSK
GeneID:
51754
Remarks:
Gene Accession: BC041377.1
Add. information Mouse polyclonal antibody raised against a full-length human C9orf127 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Ti,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human,Rat
Gene ID 51754

Accessory Products

Proteins and/or Positive Controls

Proteins for TMEM8B (2 products)

Catalog No. Species Pres. Purity   Source  

TMEM8B

TMEM8B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TMEM8B

TMEM8B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TMEM8B (3 products)

Catalog No. Species Pres. Purity   Source  

C9orf127 293T Cell Transient Overexpression Lysate(Denatured)

C9orf127 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TMEM8B overexpression lysate

TMEM8B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

TMEM8B overexpression lysate

TMEM8B overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn