TA344912 TMLHE / TMLD antibody

Rabbit Polyclonal Anti-TMLHE Antibody - C-terminal region

See related secondary antibodies

Search for all "TMLHE / TMLD"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat TMLHE / TMLD

Product Description for TMLHE / TMLD

Rabbit anti Human, Rat TMLHE / TMLD.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMLHE / TMLD

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Epsilon-trimethyllysine 2-oxoglutarate dioxygenase, TML dioxygenase, TML hydroxylase, TML-alpha-ketoglutarate dioxygenase, TMLH, Trimethyllysine dioxygenase mitochondrial
Presentation Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-Tmlhe antibody is: synthetic peptide directed towards the C-terminal region of Rat Tmlhe. Synthetic peptide located within the following region: ELWVKLKPGKVLFIDNWRVLHGRESFTGYRQLCGCYLTRDDVLNTARILG.
Application WB
Background Tmlhe is a first enzyme in the carnitine biosynthesis pathway and plays an important role in the transport of fatty acids across the inner mitochondrial membrane.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for TMLHE / TMLD (4 products)

Catalog No. Species Pres. Purity   Source  


TMLHE / TMLD Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


TMLHE / TMLD Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


TMLHE / TMLD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


TMLHE / TMLD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TMLHE / TMLD (1 products)

Catalog No. Species Pres. Purity   Source  

TMLHE overexpression lysate

TMLHE overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn