
NBP1-52896 TNPO2 antibody

See related secondary antibodies

Search for all "TNPO2"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Mouse, Rat TNPO2

Product Description for TNPO2

Rabbit anti Human, Mouse, Rat TNPO2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TNPO2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to TNPO2(transportin 2 (importin 3, karyopherin beta 2b)) The peptide sequence was selected from the C terminal of TNPO2. Peptide sequence LVQKTLAQAMMYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVA.
Background Transportin-2 (TNPO2) mediates nuclear import of HuR protein in vitro. It also participates in mRNA export from the nucleus.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 30000

Accessory Products

  • LinkedIn