NBP1-52896 TNPO2 antibody

See related secondary antibodies

Search for all "TNPO2"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat TNPO2

Product Description for TNPO2

Rabbit anti Human, Mouse, Rat TNPO2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TNPO2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to TNPO2(transportin 2 (importin 3, karyopherin beta 2b)) The peptide sequence was selected from the C terminal of TNPO2. Peptide sequence LVQKTLAQAMMYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVA.
Background Transportin-2 (TNPO2) mediates nuclear import of HuR protein in vitro. It also participates in mRNA export from the nucleus.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 30000

Accessory Products

  • LinkedIn