
NBP1-57461 TNRC6B antibody

See related secondary antibodies

Search for all "TNRC6B"

Quick Overview

Rabbit anti Human, Mouse, Rat TNRC6B

Product Description for TNRC6B

Rabbit anti Human, Mouse, Rat TNRC6B.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TNRC6B

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to TNRC6B(trinucleotide repeat containing 6B) The peptide sequence was selected from the N terminal of TNRC6B. Peptide sequence LQSESGTAPVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWG.
Background The function of TNRC6B remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 23112

Accessory Products

  • LinkedIn