NBP1-57461 TNRC6B antibody

See related secondary antibodies

Search for all "TNRC6B"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat TNRC6B

Product Description for TNRC6B

Rabbit anti Human, Mouse, Rat TNRC6B.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TNRC6B

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to TNRC6B(trinucleotide repeat containing 6B) The peptide sequence was selected from the N terminal of TNRC6B. Peptide sequence LQSESGTAPVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWG.
Background The function of TNRC6B remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 23112

Accessory Products

  • LinkedIn