TA339987 TOM1L2 antibody

Rabbit Polyclonal Anti-TOM1L2 Antibody

See related secondary antibodies

Search for all "TOM1L2"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish TOM1L2

Product Description for TOM1L2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish TOM1L2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TOM1L2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms TOM1-like protein 2, Target of Myb-like protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-TOM1L2 antibody: synthetic peptide directed towards the middle region of human TOM1L2. Synthetic peptide located within the following region: QPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSP.
Application WB
Background TOM1L2 has a probable role in protein transport.TOM1L2 may regulate growth factor-induced mitogenic sigling.
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for TOM1L2 (5 products)

Catalog No. Species Pres. Purity   Source  

TOM1L2 (transcript variant 3)

TOM1L2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TOM1L2 (1-507, His-tag)

TOM1L2 Human Purified > 80 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

TOM1L2 (1-507, His-tag)

TOM1L2 Human Purified > 80 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH


TOM1L2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


TOM1L2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TOM1L2 (1 products)

Catalog No. Species Pres. Purity   Source  

TOM1L2 293T Cell Transient Overexpression Lysate(Denatured)

TOM1L2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn