discontinued

H00010953-D01P TOMM34 antibody

See related secondary antibodies

Search for all "TOMM34"

Quick Overview

Rabbit anti Human, Mouse TOMM34

H00010953-D01P

More Views

  • H00010953-D01P
  • H00010953-D01P

Product Description for TOMM34

Rabbit anti Human, Mouse TOMM34.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for TOMM34

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Mitochondrial import receptor subunit TOM34, TOM34, Translocase of outer membrane 34 kDa subunit, URCC3
Presentation Purified
Reactivity Hu, Ms
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15785
Immunogen:
TOMM34 (NP_006800.2, 1 a.a. ~ 309 a.a) full-length human protein.
AA Sequence:
MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTS ALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPV SAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESA TYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEV KQNLH
GeneID:
10953
Remarks:
Gene Accession: NM_006809.4
Add. information Rabbit polyclonal antibody raised against a full-length human TOMM34 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ce,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse
Gene ID 10953

Accessory Products

Proteins and/or Positive Controls

Proteins for TOMM34 (5 products)

Catalog No. Species Pres. Purity   Source  

TOMM34

TOMM34 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

TOMM34 (1-309, His-tag)

TOMM34 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

TOMM34 (1-309, His-tag)

TOMM34 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

TOMM34

TOMM34 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TOMM34

TOMM34 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TOMM34 (3 products)

Catalog No. Species Pres. Purity   Source  

TOMM34 293T Cell Transient Overexpression Lysate(Denatured)

TOMM34 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TOMM34 Lysate

Western Blot: TOMM34 Lysate [NBL1-17191] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TOMM34
  Novus Biologicals Inc.

TOMM34 overexpression lysate

TOMM34 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn