discontinued

H00010953-M01 TOMM34 antibody

See related secondary antibodies

Search for all "TOMM34"

Quick Overview

Mouse anti Human TOMM34 2B5

H00010953-M01

More Views

  • H00010953-M01
  • H00010953-M01

Product Description for TOMM34

Mouse anti Human TOMM34 2B5.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for TOMM34

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Mitochondrial import receptor subunit TOM34, TOM34, Translocase of outer membrane 34 kDa subunit, URCC3
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, WB
Clonality Monoclonal
Clone 2B5
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15785
Immunogen:
TOMM34 (AAH01763, 1 a.a. ~ 310 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTS ALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPV SAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESA TYSNRALCYLVLKQYTEAVKDCTEALK
GeneID:
10953
Remarks:
Gene Accession: BC001763
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a full length recombinant TOMM34.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10953

Accessory Products

Proteins and/or Positive Controls

Proteins for TOMM34 (5 products)

Catalog No. Species Pres. Purity   Source  

TOMM34

TOMM34 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

TOMM34 (1-309, His-tag)

TOMM34 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

TOMM34 (1-309, His-tag)

TOMM34 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

TOMM34

TOMM34 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TOMM34

TOMM34 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TOMM34 (3 products)

Catalog No. Species Pres. Purity   Source  

TOMM34 293T Cell Transient Overexpression Lysate(Denatured)

TOMM34 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TOMM34 Lysate

Western Blot: TOMM34 Lysate [NBL1-17191] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TOMM34
  Novus Biologicals Inc.

TOMM34 overexpression lysate

TOMM34 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn