TA338719 TOMM40L antibody

Rabbit Polyclonal Anti-TOMM40L Antibody

See related secondary antibodies

Search for all "TOMM40L"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TOMM40L

Product Description for TOMM40L

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TOMM40L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TOMM40L

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Mitochondrial import receptor subunit TOM40B, Protein TOMM40-like, TOM40B, TOMM40B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-TOMM40L antibody: synthetic peptide directed towards the middle region of human TOMM40L. Synthetic peptide located within the following region: LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD.
Application WB
Background Potential channel-forming protein implicated in import of protein precursors into mitochondria.
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for TOMM40L (3 products)

Catalog No. Species Pres. Purity   Source  

TOMM40L (full length, N-term HIS tag)

TOMM40L Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.


TOMM40L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


TOMM40L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TOMM40L (1 products)

Catalog No. Species Pres. Purity   Source  

TOMM40L Lysate

Western Blot: TOMM40L Lysate [NBL1-17192] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TOMM40L
  Novus Biologicals Inc.
  • LinkedIn