discontinued

NBP1-90688 TOMM6 antibody

See related secondary antibodies

Search for all "TOMM6"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human TOMM6

Product Description for TOMM6

Rabbit anti Human TOMM6.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for TOMM6

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96B49
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQ
GeneID:
100188893
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 100188893

Accessory Products

Proteins and/or Positive Controls

Proteins for TOMM6 (1 products)

Catalog No. Species Pres. Purity   Source  

Translocase of outer mitochondrial membrane 6 homolog (yeast) (TOMM6), nuclear gene encoding mitochondrial protein

Translocase of outer mitochondrial membrane 6 homolog (yeast) (TOMM6), nuclear gene encoding mitochondrial protein Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for TOMM6 (1 products)

Catalog No. Species Pres. Purity   Source  

TOMM6 overexpression lysate

TOMM6 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn