NBP1-90688 TOMM6 antibody

See related secondary antibodies

Search for all "TOMM6"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TOMM6

Product Description for TOMM6

Rabbit anti Human TOMM6.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for TOMM6

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96B49
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQ
GeneID:
100188893
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 100188893

Accessory Products

Proteins and/or Positive Controls

Proteins for TOMM6 (1 products)

Catalog No. Species Pres. Purity   Source  

Translocase of outer mitochondrial membrane 6 homolog (yeast) (TOMM6), nuclear gene encoding mitochondrial protein

Translocase of outer mitochondrial membrane 6 homolog (yeast) (TOMM6), nuclear gene encoding mitochondrial protein Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for TOMM6 (1 products)

Catalog No. Species Pres. Purity   Source  

TOMM6 overexpression lysate

TOMM6 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn