TA331301 TOP1MT antibody

Rabbit Polyclonal Anti-TOP1MT Antibody

See related secondary antibodies

Search for all "TOP1MT"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish TOP1MT

Product Description for TOP1MT

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish TOP1MT.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TOP1MT

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DNA topoisomerase I mitochondrial
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-TOP1MT antibody is: synthetic peptide directed towards the C-terminal region of Human TOP1MT. Synthetic peptide located within the following region: KKRRLLEKLQEQLAQLSVQATDKEENKQVALGTSKLNYLDPRISIAWCKR.
Application WB
Background This gene encodes a mitochondrial D topoisomerase that plays a role in the modification of D topology. The encoded protein is a type IB topoisomerase and catalyzes the transient breaking and rejoining of D to relieve tension and D supercoiling generated in the mitochondrial genome during replication and transcription. Altertively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn