TA338282 TP53I3 antibody

Rabbit Polyclonal Anti-TP53I3 Antibody

See related secondary antibodies

Search for all "TP53I3"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat TP53I3

Product Description for TP53I3

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat TP53I3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TP53I3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms PIG3, Quinone oxidoreductase PIG3, Tumor protein p53-inducible protein 3, p53-induced gene 3 protein
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-TP53I3 antibody is: synthetic peptide directed towards the C-terminal region of Human TP53I3. Synthetic peptide located within the following region: SKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVL.
Application WB
Background The protein encoded by this gene is similar to oxidoreductases, which are enzymes involved in cellular responses to oxidative stresses and irradiation. This gene is induced by the tumor suppressor p53 and is thought to be involved in p53-mediated cell death. It contains a p53 consensus binding site in its promoter region and a downstream pentanucleotide microsatellite sequence. P53 has been shown to transcriptiolly activate this gene by interacting with the downstream pentanucleotide microsatellite sequence. The microsatellite is polymorphic, with a varying number of pentanucleotide repeats directly correlated with the extent of transcriptiol activation by p53. It has been suggested that the microsatellite polymorphism may be associated with differential susceptibility to cancer.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for TP53I3 (7 products)

Catalog No. Species Pres. Purity   Source  

TP53I3 (transcript variant 1)

TP53I3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

TP53I3 (transcript variant 2)

TP53I3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

TP53I3 (1-332, His-tag)

TP53I3 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €670.00
  Acris Antibodies GmbH

TP53I3 (1-332, His-tag)

TP53I3 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €250.00
  Acris Antibodies GmbH


TP53I3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


TP53I3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


SDS-Page: PIG3 Protein [NBP1-44458] - TP53I3, 37.6 kDa (352aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE Human Purified
  Novus Biologicals Inc.

Positive controls for TP53I3 (6 products)

Catalog No. Species Pres. Purity   Source  

PIG3 Lysate

Western Blot: PIG3 Lysate [NBL1-17206] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TP53I3
  Novus Biologicals Inc.

TP53I3 Lysate(Denatured)

TP53I3 Lysate(Denatured)
  Abnova Taiwan Corp.

TP53I3 Lysate(Denatured)

TP53I3 Lysate(Denatured)
  Abnova Taiwan Corp.

TP53I3 overexpression lysate

TP53I3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

TP53I3 overexpression lysate

TP53I3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

TP53I3 overexpression lysate

TP53I3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn