discontinued

H00007175-M01 TPR antibody

See related secondary antibodies

Search for all "TPR"

Quick Overview

Mouse anti Human TPR 1A8

H00007175-M01

More Views

  • H00007175-M01
  • H00007175-M01

Product Description for TPR

Mouse anti Human TPR 1A8.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for TPR

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Nucleoprotein TPR
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 1A8
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P12270
Immunogen:
TPR (NP_003283, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKRLSHSQERLVNETRECQ SLRLELEKLNNQLKALTEKNKE*
GeneID:
7175
Remarks:
Gene Accession: NM_003292
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant TPR.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7175

Accessory Products

Proteins and/or Positive Controls

Proteins for TPR (2 products)

Catalog No. Species Pres. Purity   Source  

TPR

TPR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TPR

TPR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn