discontinued

H00007052-M06 Transglutaminase-2 (TGM2) antibody

See related secondary antibodies

Search for all "Transglutaminase-2 (TGM2)"

Quick Overview

Mouse anti Human Transglutaminase-2 (TGM2) 1A6

H00007052-M06

More Views

  • H00007052-M06

Product Description for Transglutaminase-2 (TGM2)

Mouse anti Human Transglutaminase-2 (TGM2) 1A6.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Transglutaminase-2 (TGM2)

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Protein-glutamine gamma-glutamyltransferase 2, TGase C, TGase-H, Tissue transglutaminase
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1A6
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P21980
Immunogen:
TGM2 (AAH03551, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKAR FPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
GeneID:
7052
Remarks:
Gene Accession: BC003551
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant TGM2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7052

Accessory Products

Proteins and/or Positive Controls

Proteins for Transglutaminase-2 (TGM2) (22 products)

Catalog No. Species Pres. Purity   Source  

Transglutaminase-2 (TGM2) (transcript variant 2)

Transglutaminase-2 (TGM2) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Transglutaminase-2 (TGM2) (transcript variant 1)

Transglutaminase-2 (TGM2) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Transglutaminase-2 (TGM2) (His-tagged)

Transglutaminase-2 (TGM2) Human Purified > 95%.0 as determined by SDS-PAGE. Insect cells
  OriGene Technologies GmbH

Transglutaminase-2 (TGM2) (His-tagged)

Transglutaminase-2 (TGM2) Human Purified > 95%.0 as determined by SDS-PAGE. Insect cells
  OriGene Technologies GmbH

Transglutaminase-2 (TGM2) (His-tagged)

Transglutaminase-2 (TGM2) Human Purified > 95%.0 as determined by SDS-PAGE. Insect cells
  OriGene Technologies GmbH

Transglutaminase-2 (TGM2) (1-687, His-tag)

Transglutaminase-2 (TGM2) Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €940.00
  OriGene Technologies GmbH

Transglutaminase-2 (TGM2) (1-687, His-tag)

Transglutaminase-2 (TGM2) Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €370.00
  OriGene Technologies GmbH

Transglutaminase-2 (TGM2)

Transglutaminase-2 (TGM2) Human Purified > 95 % pure as determined by SDS-PAGE E. coli
  OriGene Technologies GmbH

Transglutaminase-2 (TGM2)

Transglutaminase-2 (TGM2) Human Purified > 95 % pure as determined by SDS-PAGE E. coli
  OriGene Technologies GmbH

Transglutaminase-2 (TGM2)

Transglutaminase-2 (TGM2) Human Purified > 95 % pure as determined by SDS-PAGE E. coli
  OriGene Technologies GmbH

Transglutaminase-2 (TGM2)

Transglutaminase-2 (TGM2) Human Purified E. coli
  OriGene Technologies GmbH

Transglutaminase-2 (TGM2)

Transglutaminase-2 (TGM2) Human Purified E. coli
  OriGene Technologies GmbH

Transglutaminase-2 (TGM2)

Transglutaminase-2 (TGM2) Human Purified E. coli
  OriGene Technologies GmbH

Transglutaminase-2 (TGM2)

Transglutaminase-2 (TGM2) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Transglutaminase-2 (TGM2)

Transglutaminase-2 (TGM2) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Transglutaminase-2 (TGM2)

Transglutaminase-2 (TGM2) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Transglutaminase-2 (TGM2)

Transglutaminase-2 (TGM2) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Transglutaminase-2 (TGM2)

Transglutaminase-2 (TGM2) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Transglutaminase-2 (TGM2)

Transglutaminase-2 (TGM2) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Transglutaminase-2 (TGM2)

Transglutaminase-2 (TGM2) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Transglutaminase-2 (TGM2)

Transglutaminase-2 (TGM2) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Transglutaminase-2 (TGM2)

Transglutaminase-2 (TGM2) Human Purified > 96 % Insect cells
  BBI Solutions

Positive controls for Transglutaminase-2 (TGM2) (5 products)

Catalog No. Species Pres. Purity   Source  

TGM2 293T Cell Transient Overexpression Lysate(Denatured)

TGM2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TGM2 overexpression lysate

TGM2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

TGM2 overexpression lysate

TGM2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Transglutaminase 2 Lysate

Transglutaminase 2 Lysate
  Novus Biologicals Inc.

Transglutaminase 2 Lysate

Western Blot: Transglutaminase 2 Lysate [NBL1-16867] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TGM2
  Novus Biologicals Inc.
  • LinkedIn