TA346349 Transglutaminase-3 (TGM3) antibody

Rabbit Polyclonal Anti-TGM3 Antibody

See related secondary antibodies

Search for all "Transglutaminase-3 (TGM3)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse, Rabbit, Rat Transglutaminase-3 (TGM3)

Product Description for Transglutaminase-3 (TGM3)

Rabbit anti Canine, Human, Mouse, Rabbit, Rat Transglutaminase-3 (TGM3).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Transglutaminase-3 (TGM3)

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Protein-glutamine gamma-glutamyltransferase E, TGE, TGase
Presentation Purified
Reactivity Can, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-TGM3 antibody: synthetic peptide directed towards the N terminal of human TGM3. Synthetic peptide located within the following region: MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS.
Application WB
Background Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Transglutaminase-3 (TGM3) (1 products)

Catalog No. Species Pres. Purity   Source  

Transglutaminase-3 (TGM3)

Transglutaminase-3 (TGM3) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for Transglutaminase-3 (TGM3) (1 products)

Catalog No. Species Pres. Purity   Source  

TGM3 overexpression lysate

TGM3 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn