discontinued

H00028523-B01 TRDD3 antibody

See related secondary antibodies

Search for all "TRDD3"

Quick Overview

Mouse anti Human TRDD3

H00028523-B01

More Views

  • H00028523-B01
  • H00028523-B01

Product Description for TRDD3

Mouse anti Human TRDD3.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for TRDD3

Product Category Primary Antibodies
Quantity 50 µl
Synonyms T cell receptor delta diversity 3, TCRD
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
TRDD3 (AAH22317, 1 a.a. ~ 297 a.a) full-length human protein.
AA Sequence:
MLFSSLLCVFVAFSYSGSSVAQKVTQAQSSVSMPVRKEVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQ NAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGESFLPFRGNFHYTDKLIFGKGTRVTVEPRSQPHTKPSV FVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTRSVQHDNKTVHSTDF EVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL*
Remarks:
Gene Accession: BC022317
Add. information Mouse polyclonal antibody raised against a full-length human TRDD3 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Serum
Specificity
Species:
Human

Accessory Products

  • LinkedIn