TA337742 TREML1 antibody

Rabbit Polyclonal Anti-TREML1 Antibody

See related secondary antibodies

Search for all "TREML1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human TREML1

Product Description for TREML1

Rabbit anti Canine, Human TREML1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TREML1

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms TLT-1, TLT1, Trem-like transcript 1 protein, Triggering receptor expressed on myeloid cells-like protein 1
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-TREML1 antibody is: synthetic peptide directed towards the middle region of Human TREML1. Synthetic peptide located within the following region: GSLAENAFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVLFAVM.
Application WB
Background TREML1 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 and TREM2, but it has distinct structural and functiol properties. TREML1 enhances calcium sigling in an SHP2-dependent manner.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for TREML1 (3 products)

Catalog No. Species Pres. Purity   Source  


TREML1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


TREML1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.


TREML1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

Positive controls for TREML1 (2 products)

Catalog No. Species Pres. Purity   Source  

TREML1 Lysate

Western Blot: TREML1 Lysate [NBL1-17265] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TREML1
  Novus Biologicals Inc.

TREML1 overexpression lysate

TREML1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn